Mouse Anti-A. thaliana ADC2 Antibody (MO-AB-00671W)


Cat: MO-AB-00671W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO00671W
SpecificityThis antibody binds to A. thaliana ADC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for the biosynthesis of putrescine. Catalyzes the first step of polyamine (PA) biosynthesis to produce putrescine from arginine (PubMed:14684170, PubMed:15733873, PubMed:16045477, PubMed:25409942). Is a major contributor to basal arginine decarboxylase (ADC) activity and putrescine biosynthesis (PubMed:25409942). Accumulation of putrescine plays a positive role in salt stress tolerance (PubMed:14684170). Accumulation of putrescine plays a positive role in freezing tolerance (PubMed:18701673). Production of PA is essential for normal seed development (PubMed:15733873). Controls PA homeostasis which is crucial for normal plant growth and development (PubMed:27014322).
Product OverviewMouse Anti-A. thaliana ADC2 Antibody is a mouse antibody against ADC2. It can be used for ADC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesArginine decarboxylase; EC 4.1.1.19; ADC2
UniProt IDQ93ZG4
Protein RefseqThe length of the protein is 711 amino acids long.
The sequence is show below: MPALACVDTSFVPPAYAFSDTAGDVFIPASSPTSAAVVVDRWSPSLSSSLYRIYGWGAPYFIANSSGNISVRPHGSETLPHQDIDLLKIVKKVTGPKSSGGLGLQLPLIVRFPDVLKNRLECLQSAFDYAIKSQGYDSHYQGVYPVKCXQDRFVVEDIVKFGSSFRFGLEAGSKPEILLAMSCLCKGSPDAFLVCNGFKDAEYISLALLGRKLALNTVIVLEQEEELDLVIELSQKMNVRPVIGLRAKLRTKHSGHFGSTSGEKGKFGLTTTQIVRVVRKLRQSGMLDCLQLLHFHIGSQIPSTSLLSDGVAEAAQLYCELVRLGAHMKVIDIGGGLGIDYDGSKSGESDLSVAYSLEEYAEAVVASVRVVCDRSSVKHPVICSESGRAIVSHHSVLIFEAVSADKPMVHQATPGDIQFLLEGNEEARANYEDLYAAVMRGDHESCLLYVDQLKQRCVEGFKEGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTCDSDGKINKFIGGESSLPLHELDKNGSGGRYFLGMFLGGAYEEALGGVHNLFGGPSVVRVSQSDGPHSFAVTRAVPGQSSADVLRAMQHEPELMFQTLKHRAEEMMHTKGGSEGENEEEEEDDEFNNVAASLDRSFHNMPYLATEQASPSNSLSAAISNLGFYYCDEDVYDYISA.
See other products for " ADC2 "
CBMOAB-18488FYBMouse Anti-Rice ADC2 Antibody (CBMOAB-18488FYB)
For Research Use Only | Not For Clinical Use.
Online Inquiry