Mouse Anti-A. thaliana BECN1 Antibody (CBMOAB-61781FYC)


Cat: CBMOAB-61781FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO61781FYC
SpecificityThis antibody binds to A. thaliana BECN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Introductioneclin-1 is a protein that in humans is encoded by the BECN1 gene.[5][6] Beclin-1 is a mammalian ortholog of the yeast autophagy-related gene 6 (Atg6) and BEC-1 in the C. elegans nematode.[7] This protein interacts with either BCL-2 or PI3k class III, playing a critical role in the regulation of both autophagy and cell death.
Product OverviewMouse Anti-A. thaliana BECN1 Antibody is a mouse antibody against BECN1. It can be used for BECN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeclin 1; BECN1
UniProt IDB0FZE0
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: QTQIEQPLCLECTRVLSDKLDKEVEDVNRDIQAYEACLQRLEGEARNVLSEADFLKEKLKIEEEERKLEAAIEETEKQCAVVTAELKELELKSSRFKELEERYWQEFNNFQFQLISHQEERDAILAKTEVSQAHLELLKKTNVLNDAFPIWYDGEFGTINNFRLGRLPKIPVEWDEINAAWGQACLLLHTMAQHFRPKFQYRIKILPMGSYPRIMDTNNNTYELFG.
For Research Use Only | Not For Clinical Use.
Online Inquiry