AibGenesis™ Mouse Anti-Abd-B Antibody (CBMOAB-00494FYA)


Cat: CBMOAB-00494FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00494FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster), Silkworm (Bombyx mori) WB, ELISA MO00494FYA 100 µg
MO-AB-68738W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO68738W 100 µg
MO-NAB-00693W Monoclonal D. melanogaster (Drosophila melanogaster) Gel Supershift, IF, IHC, WB NW0615 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster), Silkworm (Bombyx mori)
CloneMO00494FYA
SpecificityThis antibody binds to fruit fly Abd-B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Abd-B Antibody is a mouse antibody against Abd-B. It can be used for Abd-B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAbdominal B, isoform C; Abdominal B, isoform D; Abdominal B, isoform E; RE29418p; Abd-B
UniProt IDA4V304
Protein RefseqThe length of the protein is 270 amino acids long.
The sequence is show below: MSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry