Mouse Anti-ABF3 Antibody (CBMOAB-00187HCB)
Cat: CBMOAB-00187HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-00187HCB | Monoclonal | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO00187HB | 100 µg | ||
CBMOAB-1375FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO1375FC | 100 µg | ||
MO-DKB-0007RA | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 50 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana) |
Clone | MO00187HB |
Specificity | This antibody binds to C. elegans ABF3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | ABF3 (Abscisic acid-insensitive 5-like 6) binds to the ABA-responsive element (ABRE) and mediates stress-responsive ABA signaling. |
Product Overview | Mouse Anti-C. elegans ABF3 Antibody is a mouse antibody against ABF3. It can be used for ABF3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein ABF-3; abf-3 |
Gene ID | 186202 |
UniProt ID | O45563 |
Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: MNFSFLFFIFAFLIGLNKGSVCLTRRTDWGQLGAIFTNPVCDVWCRIRQCGPGQCKEDPMTSDEAQCVCEKCYRDSYGNAIYPGNNGLQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry