Mouse Anti-ABHD10 Antibody (MO-AB-06787R)


Cat: MO-AB-06787R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06787R Monoclonal Cattle (Bos taurus), Rhesus (Macaca mulatta) WB, ELISA MO06787R 100 µg
CBMOAB-34853FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO34853FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rhesus (Macaca mulatta)
CloneMO06787R
SpecificityThis antibody binds to Cattle ABHD10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a mitochondrially-localized enzyme that acts in liver cells as a hydrolase. The encoded protein removes glucuronide from mycophenolic acid acyl-glucuronide. There is a pseudogene for this gene on chromosome 6. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Cattle ABHD10 Antibody is a mouse antibody against ABHD10. It can be used for ABHD10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMycophenolic acid acyl-glucuronide esterase, mitochondrial; EC 3.1.1.93; Alpha/beta hydrolase domain-containing protein 10; Abhydrolase domain-containing protein 10; ABHD10
UniProt IDQ5E9H9
Protein RefseqThe length of the protein is 306 amino acids long.
The sequence is show below: MAGVGLAAVPAWVPCRRWGLAAVTFGFHHGLSTLLARKTERAPQWLRACRHKTSISFLSRPDLPNLAYKRLKGKSPGIIFIPGYISNMNGTKALAIEEFCKSLGHAYIRFDYSGVGNSDGNLEECTVGKWRKDVLSIIDDLAEGPQILVGSSLGGWLMFHAAIARPQKVVALVGVATAVDGLVTQFNQLPIETKKEIEMKGVWPMPSKYSEEGVYRIQYSVIKEAEHHCLLHSPIPVKCPVRLLHGMKDDIVPWH.
For Research Use Only | Not For Clinical Use.
Online Inquiry