Mouse Anti-ABHD11 Antibody (CBMOAB-34854FYA)


Cat: CBMOAB-34854FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34854FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO34854FYA 100 µg
CBMOAB-64443FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64443FYA 100 µg
MO-AB-06788R Monoclonal Cattle (Bos taurus) WB, ELISA MO06788R 100 µg
MO-AB-22433W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22433W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO34854FYA
SpecificityThis antibody binds to Rhesus ABHD11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein containing an alpha/beta hydrolase fold domain. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. (From NCBI)
Product OverviewMouse Anti-Rhesus ABHD11 Antibody is a mouse antibody against ABHD11. It can be used for ABHD11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABHD11
UniProt IDF7GT51
Protein RefseqThe length of the protein is 305 amino acids long.
The sequence is show below: MLRCTRAWRLPLEGLGPHSPSFARVPVAPSSSGGRGEAEPRPLPLSYSLLDGEAALPAVIFLHGLFGCKTNFNSIAKAFAQQTGRRVLTVDARNHGNSPHSPDMSYEIMSQDLQDLLPQLDLVPCVVVGHSMGGRTAMLLALQRPELVERLIAVDISPVEGTGSSHFPAYVAAMRTVNIPDGLPRSHARKLADEQLSSVVQNLAVRQYLLTNLVEVDGRLAWRLNLDALAQHLDKLLTFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIIRLFPRAQIQTVPNAGHWIHAERPQDFIDAIRGFLV.
For Research Use Only | Not For Clinical Use.
Online Inquiry