Mouse Anti-ABHD12B Antibody (CBMOAB-34859FYA)


Cat: CBMOAB-34859FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34859FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO34859FYA 100 µg
MO-AB-00873W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO00873W 100 µg
MO-AB-23941H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23941C 100 µg
MO-AB-50220W Monoclonal Marmoset WB, ELISA MO50220W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO34859FYA
SpecificityThis antibody binds to Rhesus ABHD12B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ABHD12B Antibody is a mouse antibody against ABHD12B. It can be used for ABHD12B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABHD12B
UniProt IDF7FLV1
Protein RefseqThe length of the protein is 362 amino acids long.
The sequence is show below: MDAQDCQAAATLEPPGPPAHGCVAAWWDMVDRNLRSFPHSCSTLGRKIAALYDSFTSKSLKEHVFPPLIDMLIYFNFFKAPFLVDLKKPELKIPHTVNFYLRVEPGVMLGIWHTVPSCWEEEAKGKDRCWYEAALRDGNPIVVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPTEEGLTTDAIRVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNVPGFLRTFMDAMRKDKIVFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIAHNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQWS.
For Research Use Only | Not For Clinical Use.
Online Inquiry