Mouse Anti-ABHD14A Antibody (CBMOAB-34861FYA)


Cat: CBMOAB-34861FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34861FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO34861FYA 100 µg
CBMOAB-64447FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64447FYA 100 µg
MO-AB-23942H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23942C 100 µg
MO-AB-26003W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26003W 100 µg
MO-AB-50224W Monoclonal Marmoset WB, ELISA MO50224W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO34861FYA
SpecificityThis antibody binds to Rhesus ABHD14A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPossible role in granule neuron development.
Product OverviewMouse Anti-Rhesus ABHD14A Antibody is a mouse antibody against ABHD14A. It can be used for ABHD14A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAbhydrolase domain-containing protein 14A; ABHD14A
UniProt IDI0FQM2
Protein RefseqThe length of the protein is 271 amino acids long.
The sequence is show below: MVGALCGCWFRLGGARPLIPFGPTVVQTSMSRSQVALLGLGLLLIFLLYVGLPGPPEQNSWFWGDPNVTVLAGLTPGNSPIFYREVLPLNPAHRVEVVLLHGKAFNSHTWEQLGTLQLLSQRGYRAVALDLPGFGNSAPSKEASTEAGRAALLERALQDLEVQNAVLVSPSLSGHYALPFLMRGHHQLHGFVPIAPTSTQNYTQEQFWAVKTPTLILYGELDHILAQESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry