Mouse Anti-ABHD17C Antibody (CBMOAB-34865FYA)


Cat: CBMOAB-34865FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34865FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO34865FYA 100 µg
CBMOAB-64460FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64460FYA 100 µg
MO-AB-06798R Monoclonal Cattle (Bos taurus) WB, ELISA MO06798R 100 µg
MO-AB-23949H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23949C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO34865FYA
SpecificityThis antibody binds to Rhesus ABHD17C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHydrolyzes fatty acids from S-acylated cysteine residues in proteins. Has depalmitoylating activity towards nras.
Product OverviewMouse Anti-Rhesus ABHD17C Antibody is a mouse antibody against ABHD17C. It can be used for ABHD17C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABHD17C
UniProt IDF7ENT0
Protein RefseqThe length of the protein is 258 amino acids long.
The sequence is show below: APQQPEEGAGAGPSACSLHLSERADWQYSQRELDAVEVFFSRTARDNRLGCMFVRCAPSSRYTLLFSHGNAVDLGQMCSFYIGLGSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRYGVSPENIILYGQSIGTVPTVDLASRYECAAVILHSPLMSGLRVAFPDTRKTYCFDAFPSIDKISKVTSPVLVIHGTEDEVIDFSHGLAMYERCPRAVEPLWVEGAGHNDIELYAQYLERLKQFISHELPNS.
For Research Use Only | Not For Clinical Use.
Online Inquiry