AibGenesis™ Mouse Anti-ABI1 Antibody (CBMOAB-00191HCB)


Cat: CBMOAB-00191HCB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00191HCB Monoclonal C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Arabidopsis, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Cucumber (Cucumis sativus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO00191HB 100 µg
CBMOAB-1379FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO1379FC 100 µg
CBMOAB-34872FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO34872FYA 100 µg
MO-AB-00874W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO00874W 100 µg
MO-AB-01145H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01145C 100 µg
MO-AB-06809R Monoclonal Cattle (Bos taurus) WB, ELISA MO06809R 100 µg
MO-AB-11725W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11725W 100 µg
MO-AB-28220W Monoclonal Cucumber (Cucumis sativus) WB, ELISA MO28220W 100 µg
MO-AB-50235W Monoclonal Marmoset WB, ELISA MO50235W 100 µg
MOFAB-611W Monoclonal Arabidopsis WB, IHC 100 µg
MO-DKB-0008RA Polyclonal A. thaliana (Arabidopsis thaliana) IP, WB 50 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Arabidopsis, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Cucumber (Cucumis sativus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO00191HB
SpecificityThis antibody binds to C. elegans ABI1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14. (From NCBI)
Product OverviewMouse Anti-C. elegans ABI1 Antibody is a mouse antibody against ABI1. It can be used for ABI1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein ABI-1; abi-1
Gene ID175789
UniProt IDQ10929
Protein RefseqThe length of the protein is 469 amino acids long. The sequence is show below: MSVNDLQELIERRIPDNRAQLETSHANLQQVAAYCEDNYIQSNNKSAALEESKKFAIQALASVAYQINKMVTDLHDMLALQTDKVNSLTNQVQYVSQVVDVHKEKLARREIGSLTTNKTLFKQPKIIAPAIPDEKQRYQRTPIDFSVLDGIGHGVRTSDPPRAAPISRATSSISGSSPSQFHNESPAYGVYAGERTATLGRTMRPYAPSIAPSDYRLPQVTPQSESRIGRQMSHGSEFGDHMSGGGGSGSQHGSSDYNSIYQPDRYGTIRAGGRTTVDGSFSIPRLSSAQSSAGGPESPTFPLPPPAMNYTGYVAPGSVVQQQQQQQMQQQNYGTIRKSTVNRHDLPPPPNSLLTGMSSRMPTQDDMDDLPPPPESVGGSSAYGVFAGRTESYSSSQPPSLFDTSAGWMPNEYLEKVRVLYDYDAAKEDELTLRENAIVYVLKKNDDDWYEGVLDGVTGLFPGNYVVPV.
For Research Use Only | Not For Clinical Use.
Online Inquiry