Mouse Anti-ABI1 Antibody (CBMOAB-00191HCB)
Cat: CBMOAB-00191HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-00191HCB | Monoclonal | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Arabidopsis, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Cucumber (Cucumis sativus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) | WB, ELISA | MO00191HB | 100 µg | ||
| CBMOAB-1379FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO1379FC | 100 µg | ||
| CBMOAB-34872FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO34872FYA | 100 µg | ||
| MO-AB-00874W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO00874W | 100 µg | ||
| MO-AB-01145H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01145C | 100 µg | ||
| MO-AB-06809R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO06809R | 100 µg | ||
| MO-AB-11725W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11725W | 100 µg | ||
| MO-AB-28220W | Monoclonal | Cucumber (Cucumis sativus) | WB, ELISA | MO28220W | 100 µg | ||
| MO-AB-50235W | Monoclonal | Marmoset | WB, ELISA | MO50235W | 100 µg | ||
| MOFAB-611W | Monoclonal | Arabidopsis | WB, IHC | 100 µg | |||
| MO-DKB-0008RA | Polyclonal | A. thaliana (Arabidopsis thaliana) | IP, WB | 50 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Arabidopsis, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Cucumber (Cucumis sativus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) |
| Clone | MO00191HB |
| Specificity | This antibody binds to C. elegans ABI1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14. (From NCBI) |
| Product Overview | Mouse Anti-C. elegans ABI1 Antibody is a mouse antibody against ABI1. It can be used for ABI1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein ABI-1; abi-1 |
| Gene ID | 175789 |
| UniProt ID | Q10929 |
| Protein Refseq | The length of the protein is 469 amino acids long. The sequence is show below: MSVNDLQELIERRIPDNRAQLETSHANLQQVAAYCEDNYIQSNNKSAALEESKKFAIQALASVAYQINKMVTDLHDMLALQTDKVNSLTNQVQYVSQVVDVHKEKLARREIGSLTTNKTLFKQPKIIAPAIPDEKQRYQRTPIDFSVLDGIGHGVRTSDPPRAAPISRATSSISGSSPSQFHNESPAYGVYAGERTATLGRTMRPYAPSIAPSDYRLPQVTPQSESRIGRQMSHGSEFGDHMSGGGGSGSQHGSSDYNSIYQPDRYGTIRAGGRTTVDGSFSIPRLSSAQSSAGGPESPTFPLPPPAMNYTGYVAPGSVVQQQQQQQMQQQNYGTIRKSTVNRHDLPPPPNSLLTGMSSRMPTQDDMDDLPPPPESVGGSSAYGVFAGRTESYSSSQPPSLFDTSAGWMPNEYLEKVRVLYDYDAAKEDELTLRENAIVYVLKKNDDDWYEGVLDGVTGLFPGNYVVPV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry