Mouse Anti-abL Antibody (MO-AB-30563H)


Cat: MO-AB-30563H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-30563H Monoclonal Purple sea urchin (Strongylocentrotus purpuratus), Chicken (Gallus gallus) WB, ELISA MO30563C 100 µg
Inquiry
MO-AB-00016Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00016Y 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPurple sea urchin (Strongylocentrotus purpuratus), Chicken (Gallus gallus)
CloneMO30563C
SpecificityThis antibody binds to Purple sea urchin abL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionArm and Abl proteins function cooperatively at adherens junctions in both the CNS and epidermis; critical for embryonic epithelial morphogenesis regulating cell shape changes and cell migration. Plays a critical role in transducing embryonic midline repulsive cues; may regulate cytoskeletal dynamics underlying a growth cone''s response to midline cues. The ability of pCC/MP2 axons to correctly interpret midline repulsive cues and stay on the ipsilateral side is dependent on the strength of both Slit/robo and Abl-dependent signaling pathways.
Product OverviewThis product is a mouse antibody against abL. It can be used for abL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAbL protein; abL
UniProt IDQ26633
Protein RefseqThe length of the protein is 176 amino acids long.
The sequence is show below: EFMPYGNLLEYLRDNDETSLPAVTLLYMATQVAFGMSYLEKNSFIHRDLAARNCLLGEHHLLKVADFGLARMVQGEIYTAQAGAKFPIKWTAPESLAYYKFSSKSDVWAFGILLWEIATYGCSPYPGVDLQHVYGKLEQGYRMERPEAVLRNVYKLMHKCWEWRHTDRPSFTEIHE.
See other products for " Abl "
CBMOAB-00499FYAMouse Anti-Abl Antibody (CBMOAB-00499FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry