AibGenesis™ Mouse Anti-abL Antibody (MO-AB-30563H)


Cat: MO-AB-30563H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-30563H Monoclonal Purple sea urchin (Strongylocentrotus purpuratus), Chicken (Gallus gallus) WB, ELISA MO30563C 100 µg
MO-AB-00016Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00016Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPurple sea urchin (Strongylocentrotus purpuratus), Chicken (Gallus gallus)
CloneMO30563C
SpecificityThis antibody binds to Purple sea urchin abL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against abL. It can be used for abL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAbL protein; abL
UniProt IDQ26633
Protein RefseqThe length of the protein is 176 amino acids long.
The sequence is show below: EFMPYGNLLEYLRDNDETSLPAVTLLYMATQVAFGMSYLEKNSFIHRDLAARNCLLGEHHLLKVADFGLARMVQGEIYTAQAGAKFPIKWTAPESLAYYKFSSKSDVWAFGILLWEIATYGCSPYPGVDLQHVYGKLEQGYRMERPEAVLRNVYKLMHKCWEWRHTDRPSFTEIHE.
See other products for " Abl "
For Research Use Only | Not For Clinical Use.
Online Inquiry