Mouse Anti-ACAA1 Antibody (CBMOAB-34905FYA)


Cat: CBMOAB-34905FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34905FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO34905FYA 100 µg
CBMOAB-64537FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64537FYA 100 µg
MO-AB-03334W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03334W 100 µg
MO-AB-22281W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22281W 100 µg
MO-AB-50281W Monoclonal Marmoset WB, ELISA MO50281W 100 µg
MO-AB-06825R Monoclonal Cattle (Bos taurus) WB, ELISA MO06825R 100 µg
MO-AB-01156H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01156C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO34905FYA
SpecificityThis antibody binds to Rhesus ACAA1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus ACAA1 Antibody is a mouse antibody against ACAA1. It can be used for ACAA1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACAA1
UniProt IDF6SR67
Protein RefseqThe length of the protein is 413 amino acids long.
The sequence is show below: MWFCACADGCLLTPAVSSATGGWFVELSCAMQRLQVVLGHLTGRPDSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEELGDICVGNVLQPGAGAIMARIAQFLRVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPIALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPSEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN.
For Research Use Only | Not For Clinical Use.
Online Inquiry