Mouse Anti-ACAD8 Antibody (CBMOAB-34915FYA)


Cat: CBMOAB-34915FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34915FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO34915FYA 100 µg
CBMOAB-64549FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64549FYA 100 µg
MO-AB-01158H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01158C 100 µg
MO-AB-06841R Monoclonal Cattle (Bos taurus) WB, ELISA MO06841R 100 µg
MO-AB-20425W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20425W 100 µg
MO-AB-50286W Monoclonal Marmoset WB, ELISA MO50286W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO34915FYA
SpecificityThis antibody binds to Rhesus ACAD8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency.
Product OverviewMouse Anti-Rhesus ACAD8 Antibody is a mouse antibody against ACAD8. It can be used for ACAD8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIsobutyryl-CoA dehydrogenase, mitochondrial; ACAD8
UniProt IDI0FFU0
Protein RefseqThe length of the protein is 415 amino acids long.
The sequence is show below: MLGTGCRRLGASLGCLPGGLRALVQTGHRSLSSCIDPSLGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYVQTDVGGSGLSRLDTSVIFEALATGCTSTTAYMSIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGGGESDIYVVMCRTGGPGPKGISCVVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPLANRIGDEGQGFLIAVKGLNGGRINIASCSLGAAHASVILTRDHLKVRKQFGEPLASNQYLQFMLADMATRLVAARLMIRNAAVALQEERKEAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYMRDSRVHQILEGSNEVMRMLISRSLLQE.
For Research Use Only | Not For Clinical Use.
Online Inquiry