Mouse Anti-ACBP1 Antibody (CBMOAB-00228HCB)
Cat: CBMOAB-00228HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-00228HCB | Monoclonal | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Fruit fly (Drosophila melanogaster) | WB, ELISA | MO00228HB | 100 µg | ||
CBMOAB-1412FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO1412FC | 100 µg | ||
MO-AB-02068W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02068W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Fruit fly (Drosophila melanogaster) |
Clone | MO00228HB |
Specificity | This antibody binds to C. elegans ACBP1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. |
Product Overview | Mouse Anti-C. elegans ACBP1 Antibody is a mouse antibody against ACBP1. It can be used for ACBP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Acyl-CoA-binding protein homolog 1; ACBP-1; Diazepam-binding inhibitor homolog; DBI; acbp-1 |
Gene ID | 172071 |
UniProt ID | O01805 |
Protein Refseq | The length of the protein is 86 amino acids long. The sequence is show below: MTLSFDDAAATVKTLKTSPSNDELLKLYALFKQGTVGDNTTDKPGMFDLKGKAKWSAWDEKKGLAKDDAQKAYVALVEELIAKYGA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry