Mouse Anti-ACKR4 Antibody (CBMOAB-34957FYA)


Cat: CBMOAB-34957FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34957FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) WB, ELISA MO34957FYA 100 µg
MO-AB-01173H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01173C 100 µg
MO-AB-03336W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03336W 100 µg
MO-AB-06890R Monoclonal Cattle (Bos taurus) WB, ELISA MO06890R 100 µg
MO-AB-12563W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12563W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis)
CloneMO34957FYA
SpecificityThis antibody binds to Rhesus ACKR4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the G protein-coupled receptor family, and is a receptor for C-C type chemokines. This receptor has been shown to bind dendritic cell- and T cell-activated chemokines including CCL19/ELC, CCL21/SLC, and CCL25/TECK. A pseudogene of this gene is found on chromosome 6. Alternatively spliced transcript variants encoding the same protein have been described.
Product OverviewMouse Anti-Rhesus ACKR4 Antibody is a mouse antibody against ACKR4. It can be used for ACKR4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACKR4
UniProt IDF7A3Q4
Protein RefseqThe length of the protein is 350 amino acids long.
The sequence is show below: MALEQNQSTDYYYEENETNGSYDYSQYELICIKEDVREFAKVFLPVFLTIAFVIGLAGNSTVVAIYAYYKKQRTKTDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGEIMCKITSALYTLNFVSGMQFLACISIDRYVAVTKGPSQSAVGKPCWVICFCVWMAAILLSIPQLVFYTVNDNARCIPIFPHYLGTSMKASIQMLEICIGFVVPFLIMGVCYFITARTLMKMPNIKISRPLKVLLTVVLVFIVTQLPYNIVKFCRAIDIIYSLITNCNMSKRMDIAIQITESIALFHSCLNPILYVFMGASFKNYIMKVAKKYGSWRRQRQSVEEFRFDSEGPTEPTSTFSI.
For Research Use Only | Not For Clinical Use.
Online Inquiry