Mouse Anti-ACOT9 Antibody (CBMOAB-34974FYA)


Cat: CBMOAB-34974FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34974FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) WB, ELISA MO34974FYA 100 µg
MO-AB-01182H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01182C 100 µg
MO-AB-06901R Monoclonal Cattle (Bos taurus) WB, ELISA MO06901R 100 µg
MO-AB-22857W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22857W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis)
CloneMO34974FYA
SpecificityThis antibody binds to Rhesus ACOT9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a mitochondrial acyl-CoA thioesterase of unknown function. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus ACOT9 Antibody is a mouse antibody against ACOT9. It can be used for ACOT9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACOT9
UniProt IDF6ZBG5
Protein RefseqThe length of the protein is 452 amino acids long.
The sequence is show below: RLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEGKHACSPIHVNHVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDELPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLTCYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQVNPEDCPLLFTYVQVCRLLLLEKQPAFVNPLILESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPPNAVWMENSKLKSLEICHPQERNIFNRIFGGFLMRKAYELGWATACSFGGSRPFVVAVDDIMFQKPVEVGSLLFLSSQVCFTQNNYIQVRVHSEVASLQEKEHTTTNVFHFTFMSEKEVPLVFPKTYGESMLYLDGQRHFNSMSGPATVRKDYLWNPRNTTFVEN.
For Research Use Only | Not For Clinical Use.
Online Inquiry