Mouse Anti-ACOXL Antibody (CBMOAB-34979FYA)


Cat: CBMOAB-34979FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34979FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Zebrafish (Danio rerio) WB, ELISA MO34979FYA 100 µg
CBMOAB-64693FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64693FYA 100 µg
MO-AB-06907R Monoclonal Cattle (Bos taurus) WB, ELISA MO06907R 100 µg
MO-AB-28799W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28799W 100 µg
MO-AB-34329W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34329W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Zebrafish (Danio rerio)
CloneMO34979FYA
SpecificityThis antibody binds to Rhesus ACOXL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ACOXL Antibody is a mouse antibody against ACOXL. It can be used for ACOXL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACOXL
UniProt IDF7HJC2
Protein RefseqThe length of the protein is 357 amino acids long.
The sequence is show below: MVIFDKVRIPRENPLDKFGSVAPDRQYHSPTRNKSARFSAMLAALTPSRLAVAFQAMGAMKLGLTIAVRYSRSRRHFGPKTKEEVKIIEHQTQTLWLMPHLATALALTFVSRYAGALVDEDVFQGKELVNSHSLQALVVGLKAYSTWENICCLQDCRECTGGMGYMMENRISGLKCDTDVFATFEGDTVVMLQVVGQELLAQYTKQYEEKPLFGLLQNWAESVGDKLRTSFLAFNMDTVDDLAFLLKAPKIRERVLQWGLVTRIYYKVKTKKEDFFHAWNSCLHHVASLSLAHTHRVTLEQFSLAVKSCPDQEDQTLLMKFCLLYGTKLVFQERAWYLEHKYLTPVASLRIRNQVRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry