Mouse Anti-ACSL5 Antibody (MO-AB-06925R)


Cat: MO-AB-06925R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06925R Monoclonal Cattle (Bos taurus), Pig (Sus scrofa) WB, ELISA MO06925R 100 µg
MO-AB-23504R Monoclonal Pig (Sus scrofa) WB, ELISA MO23504R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Pig (Sus scrofa)
CloneMO06925R
SpecificityThis antibody binds to Cattle ACSL5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Endoplasmic reticulum; Mitochondrion; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle ACSL5 Antibody is a mouse antibody against ACSL5. It can be used for ACSL5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcyl-CoA synthetase long-chain family member 5; ACSL5
UniProt IDQ1LZF6
Protein RefseqThe length of the protein is 683 amino acids long.
The sequence is show below: MLFIFNFLFSPLPTPALICILTFGAAIFLWLVNRPQPALPHVDLNKQSVGIEGGARRSICQKDNDLIRYYFSDAKTTYEIFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKPSQESFVGIFAQNRPEWVISEFACYTYSMVAVPLYDTLGAEAVIYIINKADIAMVICDTPQKALVLISNVEKGLTPGLKLVILMDPFEDDLKKRGEKCGVEILSLFDAENLGKENFRKPVPPAPEDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry