Mouse Anti-ACTL6B Antibody (CBMOAB-35032FYA)
Cat: CBMOAB-35032FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-35032FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO35032FYA | 100 µg | ||
| CBMOAB-64778FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO64778FYA | 100 µg | ||
| MO-AB-06946R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO06946R | 100 µg | ||
| MO-AB-50371W | Monoclonal | Marmoset | WB, ELISA | MO50371W | 100 µg | ||
| MO-DKB-01062W | Polyclonal | Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Bovine (Bos taurus), Rhesus (Macaca mulatta) | WB, IF | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio) |
| Clone | MO35032FYA |
| Specificity | This antibody binds to Rhesus ACTL6B. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. This subunit may be involved in the regulation of genes by structural modulation of their chromatin, specifically in the brain. Alternative splicing results in multiple transcript variants. |
| Product Overview | Mouse Anti-Rhesus ACTL6B Antibody is a mouse antibody against ACTL6B. It can be used for ACTL6B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ACTL6B |
| UniProt ID | F6SW56 |
| Protein Refseq | The length of the protein is 380 amino acids long. The sequence is show below: MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPPLFTPRACD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry