AibGenesis™ Mouse Anti-ACTL6B Antibody (CBMOAB-35032FYA)
Cat: CBMOAB-35032FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-35032FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO35032FYA | 100 µg | ||
| CBMOAB-64778FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO64778FYA | 100 µg | ||
| MO-AB-06946R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO06946R | 100 µg | ||
| MO-AB-50371W | Monoclonal | Marmoset | WB, ELISA | MO50371W | 100 µg | ||
| MO-DKB-01062W | Polyclonal | Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Bovine (Bos taurus), Rhesus (Macaca mulatta) | WB, IF | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio) |
| Clone | MO35032FYA |
| Specificity | This antibody binds to Rhesus ACTL6B. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. This subunit may be involved in the regulation of genes by structural modulation of their chromatin, specifically in the brain. Alternative splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus ACTL6B Antibody is a mouse antibody against ACTL6B. It can be used for ACTL6B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ACTL6B |
| UniProt ID | F6SW56 |
| Protein Refseq | The length of the protein is 380 amino acids long. The sequence is show below: MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPPLFTPRACD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry