AibGenesis™ Mouse Anti-ACTL6B Antibody (CBMOAB-35032FYA)


Cat: CBMOAB-35032FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35032FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO35032FYA 100 µg
CBMOAB-64778FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64778FYA 100 µg
MO-AB-06946R Monoclonal Cattle (Bos taurus) WB, ELISA MO06946R 100 µg
MO-AB-50371W Monoclonal Marmoset WB, ELISA MO50371W 100 µg
MO-DKB-01062W Polyclonal Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, IF 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio)
CloneMO35032FYA
SpecificityThis antibody binds to Rhesus ACTL6B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. This subunit may be involved in the regulation of genes by structural modulation of their chromatin, specifically in the brain. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus ACTL6B Antibody is a mouse antibody against ACTL6B. It can be used for ACTL6B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACTL6B
UniProt IDF6SW56
Protein RefseqThe length of the protein is 380 amino acids long.
The sequence is show below: MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPPLFTPRACD.
For Research Use Only | Not For Clinical Use.
Online Inquiry