AibGenesis™ Mouse Anti-ADAM33 Antibody (CBMOAB-35115FYA)
Cat: CBMOAB-35115FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-35115FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) | WB, ELISA | MO35115FYA | 100 µg | ||
| MO-AB-01232H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01232C | 100 µg | ||
| MO-AB-03340W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO03340W | 100 µg | ||
| MO-AB-06996R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO06996R | 100 µg | ||
| MO-AB-18566W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO18566W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) |
| Clone | MO35115FYA |
| Specificity | This antibody binds to Rhesus ADAM33. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus ADAM33 Antibody is a mouse antibody against ADAM33. It can be used for ADAM33 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Disintegrin and metalloproteinase domain-containing protein 33 isoform alpha preproprotein; ADAM33 |
| UniProt ID | H9FCS2 |
| Protein Refseq | The length of the protein is 83 amino acids long. The sequence is show below: GKLQCQGGKPSLLTPHMVPVDSTVHLDGHEVTCRGVLALPGAQLDLLGLGMVEPGTQCGPRMVCQSRRCENTAFQELHRCLTA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry