Mouse Anti-ADAM33 Antibody (CBMOAB-35115FYA)


Cat: CBMOAB-35115FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35115FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis) WB, ELISA MO35115FYA 100 µg
MO-AB-01232H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01232C 100 µg
MO-AB-03340W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03340W 100 µg
MO-AB-06996R Monoclonal Cattle (Bos taurus) WB, ELISA MO06996R 100 µg
MO-AB-18566W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18566W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis)
CloneMO35115FYA
SpecificityThis antibody binds to Rhesus ADAM33.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Rhesus ADAM33 Antibody is a mouse antibody against ADAM33. It can be used for ADAM33 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDisintegrin and metalloproteinase domain-containing protein 33 isoform alpha preproprotein; ADAM33
UniProt IDH9FCS2
Protein RefseqThe length of the protein is 83 amino acids long.
The sequence is show below: GKLQCQGGKPSLLTPHMVPVDSTVHLDGHEVTCRGVLALPGAQLDLLGLGMVEPGTQCGPRMVCQSRRCENTAFQELHRCLTA.
For Research Use Only | Not For Clinical Use.
Online Inquiry