Mouse Anti-ADAMDEC1 Antibody (CBMOAB-35121FYA)


Cat: CBMOAB-35121FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35121FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO35121FYA 100 µg
MO-AB-06999R Monoclonal Cattle (Bos taurus) WB, ELISA MO06999R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO35121FYA
SpecificityThis antibody binds to Rhesus ADAMDEC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their interactions with germinal center T cells.
Product OverviewMouse Anti-Rhesus ADAMDEC1 Antibody is a mouse antibody against ADAMDEC1. It can be used for ADAMDEC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADAMDEC1
UniProt IDF7GJP1
Protein RefseqThe length of the protein is 470 amino acids long.
The sequence is show below: MLCGTSQLPAVATMSWVLLPVLWLIVQTQAIAIKQTPELTLHEIVRPIKLHILHKREIESNQTEKHGKEERYEPEVQYQMILNGEEIILSLQKSKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASISTCHGLRGYFTHHHQRYLIKPLKSTDEKEHAIFTSNQEEQDPANYTCGVRSTGGKQGPIRISRSLKSPEQEDFLQAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSGSTTFNNFLRWHSSNLREKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSIAVIEAKKKNSVALVAVMSHELGHVLGMPDVPFDTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALKCKLKPGTDCGGDAPNHTTE.
For Research Use Only | Not For Clinical Use.
Online Inquiry