Mouse Anti-ADAMTS9 Antibody (CBMOAB-35163FYA)


Cat: CBMOAB-35163FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35163FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO35163FYA 100 µg
CBMOAB-64912FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64912FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO35163FYA
SpecificityThis antibody binds to Rhesus ADAMTS9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. Members of the ADAMTS family have been implicated in the cleavage of proteoglycans, the control of organ shape during development, and the inhibition of angiogenesis. This gene is localized to chromosome 3p14.3-p14.2, an area known to be lost in hereditary renal tumors. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. (From NCBI)
Product OverviewMouse Anti-Rhesus ADAMTS9 Antibody is a mouse antibody against ADAMTS9. It can be used for ADAMTS9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesA disintegrin and metalloproteinase with thrombospondin motifs 9 preproprotein; ADAMTS9
UniProt IDH9FLH2
Protein RefseqThe length of the protein is 113 amino acids long.
The sequence is show below: KTEKVDDGFCSSHPKPSNREKCSGECNTGGWRYSAWTECSKSCDGGTQRRRAICVNTRNDVLDDSKCTHQEKVTIQRCSEFPCPQWKSGDWSECLVTCGKGHKHRQVWCQFGE.
For Research Use Only | Not For Clinical Use.
Online Inquiry