Mouse Anti-ADAMTSL3 Antibody (CBMOAB-35166FYA)
Cat: CBMOAB-35166FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-35166FYA | Monoclonal | Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO35166FYA | 100 µg | ||
CBMOAB-64916FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO64916FYA | 100 µg | ||
MO-AB-50453W | Monoclonal | Marmoset | WB, ELISA | MO50453W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) |
Clone | MO35166FYA |
Specificity | This antibody binds to Rhesus ADAMTSL3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Rhesus ADAMTSL3 Antibody is a mouse antibody against ADAMTSL3. It can be used for ADAMTSL3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ADAMTS-like protein 3; ADAMTSL3 |
UniProt ID | H9FDX1 |
Protein Refseq | The length of the protein is 83 amino acids long. The sequence is show below: PESKIVFPQGHKKYVLQATNTRTNSNDPTGEPLPQEPFWEPGNWSRCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry