Mouse Anti-ADAMTSL3 Antibody (CBMOAB-35166FYA)


Cat: CBMOAB-35166FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35166FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO35166FYA 100 µg
CBMOAB-64916FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64916FYA 100 µg
MO-AB-50453W Monoclonal Marmoset WB, ELISA MO50453W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO35166FYA
SpecificityThis antibody binds to Rhesus ADAMTSL3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ADAMTSL3 Antibody is a mouse antibody against ADAMTSL3. It can be used for ADAMTSL3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADAMTS-like protein 3; ADAMTSL3
UniProt IDH9FDX1
Protein RefseqThe length of the protein is 83 amino acids long.
The sequence is show below: PESKIVFPQGHKKYVLQATNTRTNSNDPTGEPLPQEPFWEPGNWSRCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPL.
For Research Use Only | Not For Clinical Use.
Online Inquiry