Mouse Anti-ADAT1 Antibody (CBMOAB-35182FYA)


Cat: CBMOAB-35182FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35182FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO35182FYA 100 µg
CBMOAB-64938FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64938FYA 100 µg
MO-AB-00051Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00051Y 100 µg
MO-AB-07009R Monoclonal Cattle (Bos taurus) WB, ELISA MO07009R 100 µg
MO-AB-26629W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26629W 100 µg
MO-AB-50459W Monoclonal Marmoset WB, ELISA MO50459W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO35182FYA
SpecificityThis antibody binds to Rhesus ADAT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, proteins encoded by these genes participate in the pre-mRNA editing of nuclear transcripts. The protein encoded by this gene, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA. Alternatively spliced transcript variants have been described.
Product OverviewMouse Anti-Rhesus ADAT1 Antibody is a mouse antibody against ADAT1. It can be used for ADAT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamestRNA-specific adenosine deaminase 1; ADAT1
UniProt IDH9YYL6
Protein RefseqThe length of the protein is 502 amino acids long.
The sequence is show below: MWTADEIALLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADQDCDTPDKPAQVTKEVVSMGTGTKCIGQSKMRKSGDILNDSHAEVIARRSFQRYLLHQLQLAATLKEDSIFVPGTQKGLWKLRRDLFFVFFSSHTPCGDASIIPMLEFEDQPCCPVIRDWASSSSVEASSNLEAPGSERKCEDFDSPVTKKMRLEPMTAAREVTNGATHHQSFGKQESGPISPGINSCNLTVEGLAAVTRIAPGSAKVIDVYRTGAKCVPGEAGDSRKPGAAFHQVGLLRVKPGRGDRTCSMSCSDKMARWNVLGCQGALLMHFLEEPIYLSAVVIGKCPYSQEAMQRALTGRCQNVSALPKGFGVQELKILQSDLLFEQSRCAVQAKRADSPGRLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELFRSFQKLLSRIARDKWPDSLRVQKLDTYQDYKEAASSYQEAWSTLRKQAFGSWIRNPPDYHQFK.
For Research Use Only | Not For Clinical Use.
Online Inquiry