Mouse Anti-ADAT2 Antibody (CBMOAB-35184FYA)


Cat: CBMOAB-35184FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35184FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO35184FYA 100 µg
CBMOAB-64941FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64941FYA 100 µg
MO-AB-15594W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15594W 100 µg
MO-AB-23973H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23973C 100 µg
MO-AB-50460W Monoclonal Marmoset WB, ELISA MO50460W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO35184FYA
SpecificityThis antibody binds to Rhesus ADAT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ADAT2 Antibody is a mouse antibody against ADAT2. It can be used for ADAT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADAT2
UniProt IDF7GAS0
Protein RefseqThe length of the protein is 191 amino acids long.
The sequence is show below: MEAKAAPKSAAGGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRRSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMILPLDNGLAQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry