Mouse Anti-ADAT3 Antibody (CBMOAB-35186FYA)


Cat: CBMOAB-35186FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35186FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO35186FYA 100 µg
CBMOAB-64944FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64944FYA 100 µg
MO-AB-18818W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18818W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO35186FYA
SpecificityThis antibody binds to Rhesus ADAT3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a subunit of a tRNA-specific adenosine deaminase. This heterodimeric enzyme converts adenosine to inosine in the tRNA anticodon. A mutation in this gene causes a syndrome characterized by intellectual disability and strabismus. This gene shares its 5' exon with the overlapping gene, secretory carrier membrane protein 4 (Gene ID: 113178).
Product OverviewMouse Anti-Rhesus ADAT3 Antibody is a mouse antibody against ADAT3. It can be used for ADAT3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADAT3
UniProt IDF7HKT9
Protein RefseqThe length of the protein is 367 amino acids long.
The sequence is show below: MILCSRLCLPQSASLRMEPAPGLVEQPKCLEAGSPEPEAAPWQALPVLSEKQSGDVELVLAYAAPILDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAVRAARRAAARGLRAVGAVVVDPASDRVLATGHDCSSADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYVCTGYDLYVTREPCAMCAMALVHSRILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEECRWLDPDT.
For Research Use Only | Not For Clinical Use.
Online Inquiry