Mouse Anti-ADCY5 Antibody (CBMOAB-35197FYA)


Cat: CBMOAB-35197FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35197FYA Monoclonal Rhesus (Macaca mulatta), Dog (Canis lupus familiaris), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO35197FYA 100 µg
CBMOAB-64962FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO64962FYA 100 µg
MO-AB-00947W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO00947W 100 µg
MO-AB-07086Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07086Y 100 µg
MO-AB-23541R Monoclonal Pig (Sus scrofa) WB, ELISA MO23541R 100 µg
MO-AB-28830W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28830W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Dog (Canis lupus familiaris), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO35197FYA
SpecificityThis antibody binds to Rhesus ADCY5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the membrane-bound adenylyl cyclase enzymes. Adenylyl cyclases mediate G protein-coupled receptor signaling through the synthesis of the second messenger cAMP. Activity of the encoded protein is stimulated by the Gs alpha subunit of G protein-coupled receptors and is inhibited by protein kinase A, calcium and Gi alpha subunits. Single nucleotide polymorphisms in this gene may be associated with low birth weight and type 2 diabetes. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ADCY5 Antibody is a mouse antibody against ADCY5. It can be used for ADCY5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADCY5
UniProt IDF7H6A8
Protein RefseqThe length of the protein is 225 amino acids long.
The sequence is show below: MSSSKSVSPPGYAAQKKHRSAWGEADSRANGYPHAPGGSARGSTKKPGGAVTRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQETRAPPAASAGGTEVRPRSVEVGLEERRGKGRAAAVGVILIMAVLCNRAAFHQDHMGLACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSALHLVIALRTNAQDQFLLKQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry