Mouse Anti-ADCYAP1 Antibody (CBMOAB-35205FYA)
Cat: CBMOAB-35205FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-35205FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO35205FYA | 100 µg | ||
| MO-AB-01241H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01241C | 100 µg | ||
| MO-AB-07024R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07024R | 100 µg | ||
| MO-AB-23975H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO23975C | 100 µg | ||
| MO-AB-50477W | Monoclonal | Marmoset | WB, ELISA | MO50477W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO35205FYA |
| Specificity | This antibody binds to Rhesus ADCYAP1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus ADCYAP1 Antibody is a mouse antibody against ADCYAP1. It can be used for ADCYAP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Pituitary adenylate cyclase-activating polypeptide; ADCYAP1 |
| UniProt ID | I2CTU8 |
| Protein Refseq | The length of the protein is 176 amino acids long. The sequence is show below: MTMCSGARLALLVYGIIMHSSVYCSPAAAGLRFPGIRPEEEAYDEDGNPLQDFYDLEPPGAGSPASALRDASALYYPSDRRDVAHGILNKAYRKVLDQLSARKYLQSLVAKGVGGSLGGGVEEDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry