Mouse Anti-ADCYAP1 Antibody (CBMOAB-35205FYA)


Cat: CBMOAB-35205FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35205FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO35205FYA 100 µg
MO-AB-01241H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01241C 100 µg
MO-AB-07024R Monoclonal Cattle (Bos taurus) WB, ELISA MO07024R 100 µg
MO-AB-23975H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23975C 100 µg
MO-AB-50477W Monoclonal Marmoset WB, ELISA MO50477W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO35205FYA
SpecificityThis antibody binds to Rhesus ADCYAP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus ADCYAP1 Antibody is a mouse antibody against ADCYAP1. It can be used for ADCYAP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPituitary adenylate cyclase-activating polypeptide; ADCYAP1
UniProt IDI2CTU8
Protein RefseqThe length of the protein is 176 amino acids long.
The sequence is show below: MTMCSGARLALLVYGIIMHSSVYCSPAAAGLRFPGIRPEEEAYDEDGNPLQDFYDLEPPGAGSPASALRDASALYYPSDRRDVAHGILNKAYRKVLDQLSARKYLQSLVAKGVGGSLGGGVEEDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL.
For Research Use Only | Not For Clinical Use.
Online Inquiry