Mouse Anti-ADGB Antibody (CBMOAB-35220FYA)


Cat: CBMOAB-35220FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35220FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO35220FYA 100 µg
CBMOAB-65013FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65013FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO35220FYA
SpecificityThis antibody binds to Rhesus ADGB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionLacks conserved residue(s) required for the propagation of feature annotation.
Product OverviewMouse Anti-Rhesus ADGB Antibody is a mouse antibody against ADGB. It can be used for ADGB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADGB
UniProt IDF6TEA5
Protein RefseqThe length of the protein is 746 amino acids long.
The sequence is show below: MASKQTKKKEVHRINSAHGSDKSKDFYLFGSNVQPGSIEQKKGKFPIWPEWSEADINSEKWDAGKGAKEKDKTGKSPVFHFFEDPEGKIELPPSLKIYSWKRPQDILFSRTPVVVKNEITFDLFSANEHLLCSELMRWIISEIYAVWKIFNGGILSNYFKGTSGEPPLLPWKPWEHIYSLCKAVKGHMPLFNSYGKYVVKLYWMGCWRKITIDDFLPFDEDNNLLLPATTYEFELWPMLLSKAIIKLANNDIHVADRRELGEFTVIHALTGWLPEVISLHPGYKDKVWELLKEILPEFKLSDEASSESKLAVLDSKLKEPGKEGKEGKEIKDGKEIKDVKEFKPESSLTTLKASEKSDKVPKEKADARDIGKKRSKDGEKEKFKFSLHGSRPSSEVQYSVQSLSDCSSAIQTSHMVVYATFTPLYLFENKIFSLEKMADSAEKLREYGLSHICSHPVLVTRSRSCPLVAPPKPPPVPPWKLIRQKKETVITDEAQELIVKKPEQFLEISSPFLNYRMTPFTIPTETHYVRSLIKKGIPPGSDLPSVSETDETAMHSQTDLSQIAKATSQGNAASQVILGKGTEEQTDFGLSDAHQSDGLNLERDIVSQTTETQEKSQEELPMTNNAVSKEIWLDFEDFCVCFQNIYIFHKPSSYCLNFQKSEFKFSEERVSYYLFVDSLKPIELLVCFSALVRWGEYGALTKDSPPIEPGLLTAETFSWKSLKPGNPVLKIHTYATKATVVRLPVG.
For Research Use Only | Not For Clinical Use.
Online Inquiry