Mouse Anti-ADIG Antibody (CBMOAB-35226FYA)


Cat: CBMOAB-35226FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35226FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO35226FYA 100 µg
MO-AB-07051R Monoclonal Cattle (Bos taurus) WB, ELISA MO07051R 100 µg
MO-AB-23980H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23980C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO35226FYA
SpecificityThis antibody binds to Rhesus ADIG.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionADIG/SMAF1 is an adipocyte-specific protein that plays a role in adipocyte differentiation (Kim et al., 2005 [PubMed 15567149]; Hong et al., 2005 [PubMed 16132694]).
Product OverviewMouse Anti-Rhesus ADIG Antibody is a mouse antibody against ADIG. It can be used for ADIG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADIG
UniProt IDF7B4E4
Protein RefseqThe length of the protein is 145 amino acids long.
The sequence is show below: MLRLGALEQRPGRVLLEGDTPRPREGEALLVSLLCQVRPFHGPGGASRPTQRLGQLLCGQEAASTILEFGFPGVSRAVVMAEVDGRGLPGRQEDFGNCGASLEPTTHLLFRPTCESLQRTQPFSSIADDLQPSREPPKSGRAWEQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry