Mouse Anti-ADIPOQ Antibody (CBMOAB-35227FYA)
Cat: CBMOAB-35227FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-35227FYA | Monoclonal | Rhesus (Macaca mulatta), Bovine, Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog, Human, Mouse, Frog (Xenopus laevis), Goat (Capra hircus), Pig, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO35227FYA | 100 µg | ||
| MO-AB-00056Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00056Y | 100 µg | ||
| MO-AB-01256H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01256C | 100 µg | ||
| MO-AB-07053R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07053R | 100 µg | ||
| MO-AB-08707W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08707W | 100 µg | ||
| MO-AB-14093Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14093Y | 100 µg | ||
| MO-AB-23560R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23560R | 100 µg | ||
| MO-AB-23981H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO23981C | 100 µg | ||
| MO-AB-36672W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36672W | 100 µg | ||
| MOFY-0722-FY24 | Monoclonal | Pig | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY202 | Polyclonal | Dog, Human, Mouse | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY350 | Polyclonal | Bovine | WB, IHC, ICC, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Bovine, Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog, Human, Mouse, Frog (Xenopus laevis), Goat (Capra hircus), Pig, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO35227FYA |
| Specificity | This antibody binds to Rhesus ADIPOQ. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
| Product Overview | Mouse Anti-Rhesus ADIPOQ Antibody is a mouse antibody against ADIPOQ. It can be used for ADIPOQ detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ADIPOQ |
| UniProt ID | F7HQ03 |
| Protein Refseq | The length of the protein is 243 amino acids long. The sequence is show below: MLLGAVLLLLALPSHGQDTTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGVPGRDGRDGTAGEKGEKGDPGLIGPKGDTGETGVTGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTVPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry