Mouse Anti-ADNP2 Antibody (CBMOAB-35230FYA)


Cat: CBMOAB-35230FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35230FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO35230FYA 100 µg
MO-AB-01264H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01264C 100 µg
MO-AB-07060R Monoclonal Cattle (Bos taurus) WB, ELISA MO07060R 100 µg
MO-AB-17231W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17231W 100 µg
MO-AB-50507W Monoclonal Marmoset WB, ELISA MO50507W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO35230FYA
SpecificityThis antibody binds to Rhesus ADNP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay be involved in transcriptional regulation.
Product OverviewMouse Anti-Rhesus ADNP2 Antibody is a mouse antibody against ADNP2. It can be used for ADNP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADNP homeobox protein 2; ADNP2
UniProt IDH9F6Y1
Protein RefseqThe length of the protein is 672 amino acids long.
The sequence is show below: MTPAGVIPGQTATSGVLPTGQMVQSGVLPVGQTAPSRVLPPGQTAPLRVLPAGQVVPSGLLSPSQTVSSSAVVPVNQGVNSGVLQLSQPVVSGVLPVGQPVRPGVLQLNQTVGTNILPVNQPVRPGASQNTTFLTSGSILRQLIPTGKQVNGIPTYTLAPVSVTLPVPPGGLATVAPPQMPIQLLPSGAAAPMAGSMPGMPSPPVLVNAAQSVFVQAAAPAADTSQVLRQAKQWKTCPVCNELFPSNVYQVHMEVAHKHSESKSGEKLEPEKLAACAPFLKWMREKTVRCLSCKCLVSEEELIHHLLMHGLGCLFCPCTFHDIKGLSEHSRNRHLGKKKLPMDYSNRGFQLDVDANGNLLFPHLDFITILPKEKLGEREVYLAILAGIHSKSLVPVYVKVRPQAEGTPGSTGKRVSTCPFCFGPFVTTEAYELHLKERHHIMPTVHTVLKSPAFKCIHCCGVYTGNMTLAAIAVHLVRCRSAPKDSSSDLQVQPDFIQNSELLLVNGEVIHDSSFSVKRKLPDGHLGAEDQRRGEEQPPILNADAAPGPEKVTSVVPFKRQRNESRTEGPIVKDEALQILALDPKKYEGRSYEEKKQFLKDYFHKKPYPSKKEIELLSSLFWVWKIDVASFFGKRRYICMKAIKNHKPSVLLGFDMSELKNVKHRLNFEYEP.
For Research Use Only | Not For Clinical Use.
Online Inquiry