AibGenesis™ Mouse Anti-ADPRH Antibody (CBMOAB-35243FYA)
Cat: CBMOAB-35243FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-35243FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO35243FYA | 100 µg | ||
| CBMOAB-65075FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65075FYA | 100 µg | ||
| MO-AB-01270H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01270C | 100 µg | ||
| MO-AB-07067R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07067R | 100 µg | ||
| MO-AB-16220W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16220W | 100 µg | ||
| MO-AB-50518W | Monoclonal | Marmoset | WB, ELISA | MO50518W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) |
| Clone | MO35243FYA |
| Specificity | This antibody binds to Rhesus ADPRH. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The enzyme encoded by this gene catalyzes removal of mono-ADP-ribose from arginine residues of proteins in the ADP-ribosylation cycle. Unlike the rat and mouse enzymes that require DTT for maximal activity, the human enzyme is DTT-independent. Alternatively spliced transcript variants that encode different protein isoforms have been described. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus ADPRH Antibody is a mouse antibody against ADPRH. It can be used for ADPRH detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | [Protein ADP-ribosylarginine] hydrolase; ADPRH |
| UniProt ID | H9FJZ5 |
| Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: MTHHHPTGYLGALASALFTAYAVNARPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry