Mouse Anti-ADPRM Antibody (CBMOAB-35247FYA)


Cat: CBMOAB-35247FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35247FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO35247FYA 100 µg
CBMOAB-65080FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65080FYA 100 µg
MO-AB-07071R Monoclonal Cattle (Bos taurus) WB, ELISA MO07071R 100 µg
MO-AB-14695W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14695W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO35247FYA
SpecificityThis antibody binds to Rhesus ADPRM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus ADPRM Antibody is a mouse antibody against ADPRM. It can be used for ADPRM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADPRM
UniProt IDF6SYW4
Protein RefseqThe length of the protein is 342 amino acids long.
The sequence is show below: MDDKPSPEALSESSEHLFSFGVIADVQYADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWNNESSTPCCVLQLGDIIDGYNAQYNASEKSLELVMDTFKRLKVPVHHTWGNHEFYNFSREYLTHSKLNTKFLEDQIVHHPETMPSEDYYAYHFVPFPKFRFVLLDAYDLSVLGMDQSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYPDASDSVCLAWNYRDALAVIWSHECVVCFFAGHTHDGGYSEDPFGVYHVSLEGVIETAPDSQAFGTVHVYPDKMTLKGRGRVPDRIMNYKKERAVHC.
For Research Use Only | Not For Clinical Use.
Online Inquiry