AibGenesis™ Mouse Anti-ADRA1D Antibody (CBMOAB-35259FYA)


Cat: CBMOAB-35259FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35259FYA Monoclonal Rhesus (Macaca mulatta), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO35259FYA 100 µg
CBMOAB-65086FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65086FYA 100 µg
MO-AB-07102Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07102Y 100 µg
MO-AB-14102Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14102Y 100 µg
MO-AB-23585R Monoclonal Pig (Sus scrofa) WB, ELISA MO23585R 100 µg
MO-AB-28851W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28851W 100 µg
MO-AB-41183W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41183W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO35259FYA
SpecificityThis antibody binds to Rhesus ADRA1D.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ADRA1D Antibody is a mouse antibody against ADRA1D. It can be used for ADRA1D detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADRA1D
UniProt IDF6U0D7
Protein RefseqThe length of the protein is 272 amino acids long.
The sequence is show below: ASEVVLRIHCRGAATGADGAHGLRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQCRRRRRRRPLWRVYGHHWRASTSGLRQDCTRSSGDAPPGAPLALTALPDPDPPGTPEMQAPVASRRKPPSAFREWRLLGPLRRPTTQLRAKVSSLSHKIRAGGAQRAEAACSQRSEVEAVSLGVPHEVAEGAACQAYELADYSNLRETDI.
For Research Use Only | Not For Clinical Use.
Online Inquiry