Mouse Anti-adra2b Antibody (CBMOAB-35263FYA)
Cat: CBMOAB-35263FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-35263FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Elephant (Loxodonta africana), Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO35263FYA | 100 µg | ||
CBMOAB-65091FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65091FYA | 100 µg | ||
MO-AB-00018L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00018L | 100 µg | ||
MO-AB-00062Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00062Y | 100 µg | ||
MO-AB-06264Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06264Y | 100 µg | ||
MO-AB-07078R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07078R | 100 µg | ||
MO-AB-07105Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07105Y | 100 µg | ||
MO-AB-14104Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14104Y | 100 µg | ||
MO-AB-23586R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23586R | 100 µg | ||
MO-AB-41185W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41185W | 100 µg | ||
MO-AB-42907W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO42907W | 100 µg | ||
MO-AB-43591W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43591W | 100 µg | ||
MO-AB-50525W | Monoclonal | Marmoset | WB, ELISA | MO50525W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Elephant (Loxodonta africana), Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO35263FYA |
Specificity | This antibody binds to Rhesus adra2b. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This intronless gene encodes a seven-pass transmembrane protein. This protein is a member of a subfamily of G protein-coupled receptors that regulate neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system. |
Product Overview | Mouse Anti-Rhesus adra2b Antibody is a mouse antibody against adra2b. It can be used for adra2b detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Alpha 2B adrenergic receptor; adra2b |
UniProt ID | Q0W9D8 |
Protein Refseq | The length of the protein is 390 amino acids long. The sequence is show below: AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFWRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPNRGGALASAKLPALASLASAREVNGHSKSTGEKEEGETSEDTVTRALPPSWAALPDSGQGQKEGVCGASPEDEAEEEEEEECEPQEGPVSAASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGAQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry