AibGenesis™ Mouse Anti-ADRB1 Antibody (CBMOAB-35267FYA)


Cat: CBMOAB-35267FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35267FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Pig (Sus scrofa), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO35267FYA 100 µg
CBMOAB-65099FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65099FYA 100 µg
MO-AB-07081R Monoclonal Cattle (Bos taurus) WB, ELISA MO07081R 100 µg
MO-AB-08412W Monoclonal Cat (Felis catus) WB, ELISA MO08412W 100 µg
MO-AB-14106Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14106Y 100 µg
MO-AB-23588R Monoclonal Pig (Sus scrofa) WB, ELISA MO23588R 100 µg
MO-AB-28854W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28854W 100 µg
MO-AB-41188W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41188W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Pig (Sus scrofa), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO35267FYA
SpecificityThis antibody binds to Rhesus ADRB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. (From NCBI)
Product OverviewMouse Anti-Rhesus ADRB1 Antibody is a mouse antibody against ADRB1. It can be used for ADRB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeta-1 adrenergic receptor; ADRB1
UniProt IDG8HJ64
Protein RefseqThe length of the protein is 116 amino acids long.
The sequence is show below: RWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLC.
For Research Use Only | Not For Clinical Use.
Online Inquiry