Mouse Anti-ADTRP Antibody (CBMOAB-35278FYA)


Cat: CBMOAB-35278FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35278FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO35278FYA 100 µg
MO-AB-23985H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO23985C 100 µg
MO-AB-50538W Monoclonal Marmoset WB, ELISA MO50538W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO35278FYA
SpecificityThis antibody binds to Rhesus ADTRP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRegulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).
Product OverviewMouse Anti-Rhesus ADTRP Antibody is a mouse antibody against ADTRP. It can be used for ADTRP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADTRP
UniProt IDF7HLH0
Protein RefseqThe length of the protein is 254 amino acids long.
The sequence is show below: MTKTSTCIYHFLVLSWYTFLNYYISQEGKDKVKPKIFANGARWKYLTLLNLLLQTIFYGVTCLDDVLKRIKGRKDIKFLTAFRDLLFAILAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPAWLNHAMHTFIFPITLVEVVLRPHSYPSKKTGLTLLAAANITYIIRILWLYFETGTWVYPVFAKLSLVGLAAFFSLSHIFIASIYLLGEKLNHWKWGNVQILQRWKLESLLCFQWPDWKSPAKHQVVKNIR.
For Research Use Only | Not For Clinical Use.
Online Inquiry