Mouse Anti-AGO1 Antibody (CBMOAB-1839FYC)


Cat: CBMOAB-1839FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
  • Reference
  • Relate Reference Data
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-1839FYC Monoclonal WB, ELISA MO1839FC 100 µg
CBMOAB-00760FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO00760FYA 100 µg
MO-AB-08291W Monoclonal Cat (Felis catus) WB, ELISA MO08291W 100 µg
MO-AB-15590W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15590W 100 µg
MO-AB-28888W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28888W 100 µg
MO-AB-34345W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34345W 100 µg
MO-AB-38433W Monoclonal Gorilla WB, ELISA MO38433W 100 µg
MO-AB-41195W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41195W 100 µg
MO-AB-43607W Monoclonal Horse (Equus caballus) WB, ELISA MO43607W 100 µg
MO-AB-50592W Monoclonal Marmoset WB, ELISA MO50592W 100 µg
MO-AB-68776W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO68776W 100 µg
MO-AB-07125R Monoclonal Cattle (Bos taurus) WB, ELISA MO07125R 100 µg
MO-AB-23620R Monoclonal Pig (Sus scrofa) WB, ELISA MO23620R 100 µg
MO-AB-22820H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO22820C 100 µg
MO-AB-30564H Monoclonal Purple sea urchin (Strongylocentrotus purpuratus) WB, ELISA MO30564C 100 µg
MO-AB-34120H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34120C 100 µg
MO-AB-00023L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00023L 100 µg
MO-AB-07111Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07111Y 100 µg
MO-AB-14132Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14132Y 100 µg
MO-DKB-0026RA Polyclonal WB, ELISA 50 µg
MO-DKB-02393W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); N. benthamiana (Nicotiana benthamiana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Fruit fly (Drosophila melanogaster), Gorilla, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Purple sea urchin (Strongylocentrotus purpuratus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Silkworm (Bombyx mori), Tomato (Lycopersicon esculentum)
CloneMO1839FC
SpecificityThis antibody binds to Arabidopsis AGO1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAGO1 is physically associated with miRNAs, transgene-derived siRNAs, and transgene-derived siRNAs, but not virus-derived siRNAs and 24-nt siRNAs involved in chromatin silencing.
Product OverviewMouse Anti-Arabidopsis AGO1 (clone MO1839FC) Antibody (CBMOAB-1839FYC) is a mouse antibody against AGO1. It can be used for AGO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesArgonaute 1, RISC Catalytic Component; Argonaute RISC Catalytic Component 1; Eukaryotic Translation Initiation Factor 2C, 1; Putative RNA-Binding Protein Q99; Argonaute1; EIF-2C 1; EIF2C 1; EIF2C1; HAgo1
UniProt IDB2CSW6
Protein RefseqThe length of the protein is 153 amino acids long. The sequence is show below: GFQQGGGQHQGGRGYTPQPQQGGRGGRGYGQPPQQQQQYGGPQEYQGRGRGGPPHQGGRGGYGGGRGSGPPQRQSVPELHQATSPTYQAVSSQPTLSEVSPTQVPEPTVLAQQFEQLSVEQGAPSQAIQPIPSSSKAFKFPMRPGKGQSGKRC.

Reference

Reference1. Baumberger, N., & Baulcombe, D. C. (2005). Arabidopsis ARGONAUTE1 is an RNA Slicer that selectively recruits microRNAs and short interfering RNAs. Proceedings of the National Academy of Sciences, 102(33), 11928-11933.
2. Ebhardt, H. A., Tsang, H. H., Dai, D. C., Liu, Y., Bostan, B., & Fahlman, R. P. (2009). Meta-analysis of small RNA-sequencing errors reveals ubiquitous post-transcriptional RNA modifications. Nucleic acids research, 37(8), 2461-2470.

Relate Reference Data

Figure 1 Generation of epitope-tagged AGO1 transgenic Arabidopsis. (A) Diagram of the FLAG-AGO1 construct. Positions of the restriction sites used for the cloning are given relative to the start codon.
Reference: Baumberger, N., & Baulcombe, D. C. (2005). Arabidopsis ARGONAUTE1 is an RNA Slicer that selectively recruits microRNAs and short interfering RNAs. Proceedings of the National Academy of Sciences, 102(33), 11928-11933.

Figure 2 AGO1 recruitment of small RNAs. Immunoprecipitation of FLAG-AGO1. FLAG-AGO1 was immunoprecipitated from crude inflorescence extract as described in Materials and Methods.
Reference: Baumberger, N., & Baulcombe, D. C. (2005). Arabidopsis ARGONAUTE1 is an RNA Slicer that selectively recruits microRNAs and short interfering RNAs. Proceedings of the National Academy of Sciences, 102(33), 11928-11933.

For Research Use Only | Not For Clinical Use.
Online Inquiry