AibGenesis™ Mouse Anti-AIFM2 Antibody (CBMOAB-35380FYA)


Cat: CBMOAB-35380FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35380FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset WB, ELISA MO35380FYA 100 µg
MO-AB-07164R Monoclonal Cattle (Bos taurus) WB, ELISA MO07164R 100 µg
MO-AB-18390W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18390W 100 µg
MO-AB-34353W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34353W 100 µg
MO-AB-50624W Monoclonal Marmoset WB, ELISA MO50624W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset
CloneMO35380FYA
SpecificityThis antibody binds to Rhesus AIFM2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a flavoprotein oxidoreductase that binds single stranded DNA and is thought to contribute to apoptosis in the presence of bacterial and viral DNA. The expression of this gene is also found to be induced by tumor suppressor protein p53 in colon cancer cells. (From NCBI)
Product OverviewMouse Anti-Rhesus AIFM2 Antibody is a mouse antibody against AIFM2. It can be used for AIFM2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesApoptosis-inducing factor 2; AIFM2
UniProt IDI2CVX9
Protein RefseqThe length of the protein is 373 amino acids long.
The sequence is show below: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNIPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQTVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINTSAYRNAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMKQSPP.
For Research Use Only | Not For Clinical Use.
Online Inquiry