Mouse Anti-AK1 Antibody (CBMOAB-0758FYC)
Cat: CBMOAB-0758FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-0758FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Gorilla, Marmoset, Medaka (Oryzias latipes), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO0758FC | 100 µg | ||
CBMOAB-35398FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO35398FYA | 100 µg | ||
CBMOAB-65342FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65342FYA | 100 µg | ||
MO-AB-08409W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08409W | 100 µg | ||
MO-AB-15852W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15852W | 100 µg | ||
MO-AB-28901W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO28901W | 100 µg | ||
MO-AB-38435W | Monoclonal | Gorilla | WB, ELISA | MO38435W | 100 µg | ||
MO-AB-50634W | Monoclonal | Marmoset | WB, ELISA | MO50634W | 100 µg | ||
MO-AB-07173R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07173R | 100 µg | ||
MO-AB-00035R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00035R | 100 µg | ||
MO-AB-01317H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01317C | 100 µg | ||
MO-AB-24012H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24012C | 100 µg | ||
MO-AB-10612Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10612Y | 100 µg | ||
MO-AB-14147Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14147Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Gorilla, Marmoset, Medaka (Oryzias latipes), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO0758FC |
Specificity | This antibody binds to Arabidopsis AK1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. |
Product Overview | Mouse Anti-Arabidopsis AK1 Antibody is a mouse antibody against AK1. It can be used for AK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adenylate Kinase 1; Adenylate Monophosphate Kinase; ATP-AMP Transphosphorylase 1; ATP:AMP Phosphotransferase; EC 2.7.4.3; Myokinase; Testis Secretory Sperm Binding Protein Li 58j |
UniProt ID | Q38974 |
Protein Refseq | The length of the protein is 57 amino acids long. The sequence is show below: KPSNVLLDQDMVPKISDFGMSKLFDKRAAAANTTKIVGTYGYMSPEYAEEGIYSSKS. |
See other products for " AK1 "
MO-AB-07128Y | Mouse Anti-AK1 Antibody (MO-AB-07128Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry