Mouse Anti-AK6 Antibody (MO-AB-10616Y)
Cat: MO-AB-10616Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-10616Y | Monoclonal | O. mykiss (Oncorhynchus mykiss), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Gorilla, Guinea pig (Cavia porcellus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO10616Y | 100 µg | ||
CBMOAB-1984FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO1984FC | 100 µg | ||
CBMOAB-00778FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO00778FYA | 100 µg | ||
CBMOAB-65350FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65350FYA | 100 µg | ||
MO-AB-38438W | Monoclonal | Gorilla | WB, ELISA | MO38438W | 100 µg | ||
MO-AB-41204W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41204W | 100 µg | ||
MO-AB-50644W | Monoclonal | Marmoset | WB, ELISA | MO50644W | 100 µg | ||
MO-AB-07178R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07178R | 100 µg | ||
MO-AB-00038R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00038R | 100 µg | ||
MO-AB-24018H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24018C | 100 µg | ||
MO-AB-32819H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32819C | 100 µg | ||
MO-AB-00030L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00030L | 100 µg | ||
MO-AB-07136Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07136Y | 100 µg | ||
MO-AB-14150Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14150Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | O. mykiss (Oncorhynchus mykiss), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Gorilla, Guinea pig (Cavia porcellus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO10616Y |
Specificity | This antibody binds to O. mykiss AK6. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. May have a role in nuclear energy homeostasis. Has also ATPase activity. May be involved in regulation of Cajal body (CB) formation. |
Product Overview | This product is a mouse antibody against AK6. It can be used for AK6 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adenylate kinase isoenzyme 6; AK6; EC 2.7.4.3; Coilin-interacting nuclear ATPase protein; Dual activity adenylate kinase/ATPase; ak6; cinap |
UniProt ID | A0A060Y6L0 |
Protein Refseq | The length of the protein is 174 amino acids long. The sequence is show below: MKIMKRPNILLTGTPGVGKTTLGKELAQRTGLTYVNVGDLAQEGQLFDGFDEEYQCPVLDEDRVVDELEDKMGDGGVIVDYHGCDFFPERWFQIVFVLRTDNTNLYSRLEGRGYTGKKLQDNVQCEIFQTIYEEAMEAYKEEIVHQLPSNEPEDLERNLEQVVQWIEQWVKDNN. |
See other products for " ak6 "
MO-AB-01321H | Mouse Anti-ak6 Antibody (MO-AB-01321H) |
MO-AB-19963W | Mouse Anti-AK6 Antibody (MO-AB-19963W) |
MO-AB-00099Y | Mouse Anti-AK6 Antibody (MO-AB-00099Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry