Mouse Anti-AKR1B1 Antibody (CBMOAB-35448FYA)


Cat: CBMOAB-35448FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35448FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO35448FYA 100 µg
CBMOAB-65411FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65411FYA 100 µg
MO-AB-01331H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01331C 100 µg
MO-AB-07141Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07141Y 100 µg
MO-AB-07194R Monoclonal Cattle (Bos taurus) WB, ELISA MO07194R 100 µg
MO-AB-13519W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13519W 100 µg
MO-AB-50665W Monoclonal Marmoset WB, ELISA MO50665W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO35448FYA
SpecificityThis antibody binds to Rhesus AKR1B1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. (From NCBI)
Product OverviewMouse Anti-Rhesus AKR1B1 Antibody is a mouse antibody against AKR1B1. It can be used for AKR1B1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAKR1B1
UniProt IDF7AZF0
Protein RefseqThe length of the protein is 312 amino acids long.
The sequence is show below: MASHLVLNNGAKMRILGLGTWKSPPGQVTEAVKVAISVGYHHIDCAHVYQNENEVGVAIQEKLREQVKREERFIISKLWCTYHGKGLAKKTLSGLKLDYLYLYLIHWLTDFKPGKEFFPLDESGNVVPGDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVERLLNKPGLKYKPVVNQIECHLYLTQKKLIQYCQSKGIVVTAYSPLGTPDRPWANPEEASLLGDPRIKAIAANHNKKKTAQVLIRFPMQRNLVVIPKSVTPELIADNFKVFDFELSSQDMTALLSYNRNWRVCALVRCASYKDYPFHGEF.
For Research Use Only | Not For Clinical Use.
Online Inquiry