AibGenesis™ Mouse Anti-AKR1D1 Antibody (CBMOAB-35452FYA)


Cat: CBMOAB-35452FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35452FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus) WB, ELISA MO35452FYA 100 µg
MO-AB-01336H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01336C 100 µg
MO-AB-07149Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07149Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus)
CloneMO35452FYA
SpecificityThis antibody binds to Rhesus AKR1D1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet. (From NCBI)
Product OverviewMouse Anti-Rhesus AKR1D1 Antibody is a mouse antibody against AKR1D1. It can be used for AKR1D1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAKR1D1
UniProt IDF7GRP5
Protein RefseqThe length of the protein is 146 amino acids long.
The sequence is show below: FFFQPGDEVYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKYKPVSNQVECHPYFTQPKLLKFCQQHDIVIIAYSPLGTSRNPIWRQLHKLALLDLPILRVPLPSMHTLHSEKLVTGDLQCPG.
For Research Use Only | Not For Clinical Use.
Online Inquiry