Mouse Anti-AKR7A2 Antibody (CBMOAB-35457FYA)


Cat: CBMOAB-35457FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35457FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Zebrafish (Danio rerio), Marmoset WB, ELISA MO35457FYA 100 µg
MO-AB-01337H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01337C 100 µg
MO-AB-07198R Monoclonal Cattle (Bos taurus) WB, ELISA MO07198R 100 µg
MO-AB-20250W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20250W 100 µg
MO-AB-50672W Monoclonal Marmoset WB, ELISA MO50672W 100 µg
MO-NAB-00339W Monoclonal Human (Homo sapiens), Zebrafish (Danio rerio) WB, ICC, IHC-P NW0267 100 µg
MO-NAB-00477W Monoclonal Human (Homo sapiens), Zebrafish (Danio rerio) WB, IF NW0399 100 µg
MO-DKB-01519W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Rhesus (Macaca mulatta) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Zebrafish (Danio rerio), Marmoset
CloneMO35457FYA
SpecificityThis antibody binds to Rhesus AKR7A2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the aldo/keto reductase (AKR) superfamily and AKR7 family, which are involved in the detoxification of aldehydes and ketones. The AKR7 family consists of 3 genes that are present in a cluster on the p arm of chromosome 1. This protein, thought to be localized in the golgi, catalyzes the NADPH-dependent reduction of succinic semialdehyde to the endogenous neuromodulator, gamma-hydroxybutyrate. It may also function as a detoxication enzyme in the reduction of aflatoxin B1 and 2-carboxybenzaldehyde. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus AKR7A2 Antibody is a mouse antibody against AKR7A2. It can be used for AKR7A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAflatoxin B1 aldehyde reductase member 2; AKR7A2
UniProt IDI2CY62
Protein RefseqThe length of the protein is 359 amino acids long.
The sequence is show below: MLSAASRVVSRAAVHCALSSPPPEARALAMSRPPPPRVATVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSLRSQLETSLKRLQCPRVDLFYLHAPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWIVPTVYQGMYNATTRQVETELLPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFQAIALVEKALQAAYGTSVPSMTSAALRWMYHHSQLQGAHGDTVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR.
For Research Use Only | Not For Clinical Use.
Online Inquiry