Mouse Anti-AKR7A2 Antibody (CBMOAB-35457FYA)
Cat: CBMOAB-35457FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-35457FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Zebrafish (Danio rerio), Marmoset | WB, ELISA | MO35457FYA | 100 µg | ||
MO-AB-01337H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01337C | 100 µg | ||
MO-AB-07198R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07198R | 100 µg | ||
MO-AB-20250W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20250W | 100 µg | ||
MO-AB-50672W | Monoclonal | Marmoset | WB, ELISA | MO50672W | 100 µg | ||
MO-NAB-00339W | Monoclonal | Human (Homo sapiens), Zebrafish (Danio rerio) | WB, ICC, IHC-P | NW0267 | 100 µg | ||
MO-NAB-00477W | Monoclonal | Human (Homo sapiens), Zebrafish (Danio rerio) | WB, IF | NW0399 | 100 µg | ||
MO-DKB-01519W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Rhesus (Macaca mulatta) | WB | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Zebrafish (Danio rerio), Marmoset |
Clone | MO35457FYA |
Specificity | This antibody binds to Rhesus AKR7A2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene belongs to the aldo/keto reductase (AKR) superfamily and AKR7 family, which are involved in the detoxification of aldehydes and ketones. The AKR7 family consists of 3 genes that are present in a cluster on the p arm of chromosome 1. This protein, thought to be localized in the golgi, catalyzes the NADPH-dependent reduction of succinic semialdehyde to the endogenous neuromodulator, gamma-hydroxybutyrate. It may also function as a detoxication enzyme in the reduction of aflatoxin B1 and 2-carboxybenzaldehyde. Alternative splicing results in multiple transcript variants. (From NCBI) |
Product Overview | Mouse Anti-Rhesus AKR7A2 Antibody is a mouse antibody against AKR7A2. It can be used for AKR7A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Aflatoxin B1 aldehyde reductase member 2; AKR7A2 |
UniProt ID | I2CY62 |
Protein Refseq | The length of the protein is 359 amino acids long. The sequence is show below: MLSAASRVVSRAAVHCALSSPPPEARALAMSRPPPPRVATVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSLRSQLETSLKRLQCPRVDLFYLHAPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWIVPTVYQGMYNATTRQVETELLPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFQAIALVEKALQAAYGTSVPSMTSAALRWMYHHSQLQGAHGDTVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry