Mouse Anti-ALDH1A2 Antibody (CBMOAB-35476FYA)


Cat: CBMOAB-35476FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35476FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset, Medaka (Oryzias latipes), Zebrafish (Danio rerio) WB, ELISA MO35476FYA 100 µg
CBMOAB-65469FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65469FYA 100 µg
MO-AB-00041R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00041R 100 µg
MO-AB-01008W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01008W 100 µg
MO-AB-01351H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01351C 100 µg
MO-AB-50694W Monoclonal Marmoset WB, ELISA MO50694W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset, Medaka (Oryzias latipes), Zebrafish (Danio rerio)
CloneMO35476FYA
SpecificityThis antibody binds to Rhesus ALDH1A2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis protein belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Four transcript variants encoding distinct isoforms have been identified for this gene.
Product OverviewMouse Anti-Rhesus ALDH1A2 Antibody is a mouse antibody against ALDH1A2. It can be used for ALDH1A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesALDH1A2
UniProt IDF7D2Y0
Protein RefseqThe length of the protein is 440 amino acids long.
The sequence is show below: IFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLLTATSASQTMESLNGGKPFLQAFYVDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS.
For Research Use Only | Not For Clinical Use.
Online Inquiry