Mouse Anti-AMBP Antibody (CBMOAB-35576FYA)
Cat: CBMOAB-35576FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-35576FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Frog (Xenopus laevis), Guinea pig, Human, Mouse, Rat, Zebrafish, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Zebrafish (Danio rerio) | WB, ELISA | MO35576FYA | 100 µg | ||
| CBMOAB-65627FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65627FYA | 100 µg | ||
| MO-AB-01386H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01386C | 100 µg | ||
| MO-AB-07283R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07283R | 100 µg | ||
| MO-AB-08279W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08279W | 100 µg | ||
| MO-AB-10620Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10620Y | 100 µg | ||
| MO-AB-23693R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23693R | 100 µg | ||
| MOFAB-025W | Polyclonal | Human, Mouse, Rat, Zebrafish | ELISA, WB, IP | 100 µg | |||
| MOFY-0622-FY73 | Polyclonal | Guinea pig | WB, IHC, ICC, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Frog (Xenopus laevis), Guinea pig, Human, Mouse, Rat, Zebrafish, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Zebrafish (Danio rerio) |
| Clone | MO35576FYA |
| Specificity | This antibody binds to Rhesus AMBP. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes. |
| Product Overview | Mouse Anti-Rhesus AMBP Antibody is a mouse antibody against AMBP. It can be used for AMBP detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | AMBP |
| UniProt ID | F6UQI4 |
| Protein Refseq | The length of the protein is 341 amino acids long. The sequence is show below: MRSLGALLLLLSACLVVSAGPVPTPPDNIQVQENFNVSRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGTTEAEISMTSTRWRKGVCEEMSGAYEKTDTDGKFLYHKSSKWSGRHAHSLLCLKYLDVLSSPCLCNRSSHLAEMETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRARRAVLPQEEEGSGGGRLVTDVTKKEDSCQLGHSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFMTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFTYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry