AibGenesis™ Mouse Anti-AMH Antibody (MO-AB-00118Y)


Cat: MO-AB-00118Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00118Y Monoclonal Chicken (Gallus gallus), Cattle (Bos taurus), Frog (Xenopus laevis), Goat (Capra hircus), Horse (Equus caballus), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO00118Y 100 µg
CBMOAB-65646FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65646FYA 100 µg
MO-AB-36692W Monoclonal Goat (Capra hircus) WB, ELISA MO36692W 100 µg
MO-AB-43651W Monoclonal Horse (Equus caballus) WB, ELISA MO43651W 100 µg
MO-AB-07299R Monoclonal Cattle (Bos taurus) WB, ELISA MO07299R 100 µg
MO-AB-00055R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00055R 100 µg
MO-AB-23702R Monoclonal Pig (Sus scrofa) WB, ELISA MO23702R 100 µg
MO-AB-01392H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01392C 100 µg
MO-AB-32826H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO32826C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChicken (Gallus gallus), Cattle (Bos taurus), Frog (Xenopus laevis), Goat (Capra hircus), Horse (Equus caballus), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO00118Y
SpecificityThis antibody binds to Chicken AMH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate N- and C-terminal cleavage products that homodimerize and associate to form a biologically active noncovalent complex. This complex binds to the anti-Mullerian hormone receptor type 2 and causes the regression of Mullerian ducts in the male embryo that would otherwise differentiate into the uterus and fallopian tubes. This protein also plays a role in Leydig cell differentiation and function and follicular development in adult females. Mutations in this gene result in persistent Mullerian duct syndrome. (From NCBI)
Product OverviewThis product is a mouse antibody against AMH. It can be used for AMH detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnti-Mullerian hormone; AMH
UniProt IDQ0P0G6
Protein RefseqThe length of the protein is 174 amino acids long. The sequence is show below: MKAALGVLLPYLVLLLRSTALPRKGTPGAEAVLEQSLSEEMGLGAKRENVSRARPGLAVRPKMTVASRLLPEPAASCTQADGSSLQPWPLGGLEGPVCRLKMDRNEVPPSHLEVVGVLTRYESAFIKVLRAGWEHRSPETFGLCPGGDAQTVLRPLQQLQEHLAGPGMGLQRFL.
See other products for " AMH "
For Research Use Only | Not For Clinical Use.
Online Inquiry