Mouse Anti-AMH Antibody (MO-AB-00118Y)
Cat: MO-AB-00118Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-00118Y | Monoclonal | Chicken (Gallus gallus), Cattle (Bos taurus), Frog (Xenopus laevis), Goat (Capra hircus), Horse (Equus caballus), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Zebrafish (Danio rerio) | WB, ELISA | MO00118Y | 100 µg | ||
| CBMOAB-65646FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65646FYA | 100 µg | ||
| MO-AB-36692W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36692W | 100 µg | ||
| MO-AB-43651W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43651W | 100 µg | ||
| MO-AB-07299R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07299R | 100 µg | ||
| MO-AB-00055R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00055R | 100 µg | ||
| MO-AB-23702R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23702R | 100 µg | ||
| MO-AB-01392H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01392C | 100 µg | ||
| MO-AB-32826H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32826C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Chicken (Gallus gallus), Cattle (Bos taurus), Frog (Xenopus laevis), Goat (Capra hircus), Horse (Equus caballus), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Zebrafish (Danio rerio) |
| Clone | MO00118Y |
| Specificity | This antibody binds to Chicken AMH. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate N- and C-terminal cleavage products that homodimerize and associate to form a biologically active noncovalent complex. This complex binds to the anti-Mullerian hormone receptor type 2 and causes the regression of Mullerian ducts in the male embryo that would otherwise differentiate into the uterus and fallopian tubes. This protein also plays a role in Leydig cell differentiation and function and follicular development in adult females. Mutations in this gene result in persistent Mullerian duct syndrome. |
| Product Overview | This product is a mouse antibody against AMH. It can be used for AMH detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Anti-Mullerian hormone; AMH |
| UniProt ID | Q0P0G6 |
| Protein Refseq | The length of the protein is 174 amino acids long. The sequence is show below: MKAALGVLLPYLVLLLRSTALPRKGTPGAEAVLEQSLSEEMGLGAKRENVSRARPGLAVRPKMTVASRLLPEPAASCTQADGSSLQPWPLGGLEGPVCRLKMDRNEVPPSHLEVVGVLTRYESAFIKVLRAGWEHRSPETFGLCPGGDAQTVLRPLQQLQEHLAGPGMGLQRFL. |
See other products for " AMH "
| MO-AB-14176Y | Mouse Anti-AMH Antibody (MO-AB-14176Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry