AibGenesis™ Mouse Anti-ANP32E Antibody (CBMOAB-35867FYA)


Cat: CBMOAB-35867FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35867FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO35867FYA 100 µg
CBMOAB-65935FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65935FYA 100 µg
MO-AB-07394R Monoclonal Cattle (Bos taurus) WB, ELISA MO07394R 100 µg
MO-AB-16370W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16370W 100 µg
MO-AB-43673W Monoclonal Horse (Equus caballus) WB, ELISA MO43673W 100 µg
MO-AB-50934W Monoclonal Marmoset WB, ELISA MO50934W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Zebrafish (Danio rerio)
CloneMO35867FYA
SpecificityThis antibody binds to Rhesus ANP32E.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistone chaperone that specifically mediates the genome-wide removal of histone H2A.Z/H2AFZ from the nucleosome: removes H2A.Z/H2AFZ from its normal sites of deposition, especially from enhancer and insulator regions. Not involved in deposition of H2A.Z/H2AFZ in the nucleosome. May stabilize the evicted H2A.Z/H2AFZ-H2B dimer, thus shifting the equilibrium towards dissociation and the off-chromatin state (PubMed:24463511). Inhibits activity of protein phosphatase 2A (PP2A). Does not inhibit protein phosphatase 1. May play a role in cerebellar development and synaptogenesis. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus ANP32E Antibody is a mouse antibody against ANP32E. It can be used for ANP32E detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLeucine-rich acidic nuclear phosphoprotein 32 family, member E; ANP32E
UniProt IDQ3YAN1
Protein RefseqThe length of the protein is 158 amino acids long.
The sequence is show below: VEALQNLKNLKSLDLFNCEITNLEDYRESIFELLQQITYLDGFDQEDNEAPDSEEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEDEDEDEDEDEDEAGSELGEGEEEVGLSYLMKEEIQDEEDDDDYVEEGEEEEEEEEEGLRGGKRKRDAEDDG.
For Research Use Only | Not For Clinical Use.
Online Inquiry