Mouse Anti-ANXA9 Antibody (CBMOAB-35907FYA)
Cat: CBMOAB-35907FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-35907FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries) | WB, ELISA | MO35907FYA | 100 µg | ||
MO-AB-00085L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00085L | 100 µg | ||
MO-AB-01453H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01453C | 100 µg | ||
MO-AB-07419R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07419R | 100 µg | ||
MO-AB-09192W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09192W | 100 µg | ||
MO-AB-14208Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14208Y | 100 µg | ||
MO-AB-23763R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23763R | 100 µg | ||
MO-AB-25021W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25021W | 100 µg | ||
MO-AB-28971W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO28971W | 100 µg | ||
MO-AB-34390W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34390W | 100 µg | ||
MO-AB-41244W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41244W | 100 µg | ||
MO-AB-43685W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43685W | 100 µg | ||
MO-AB-50971W | Monoclonal | Marmoset | WB, ELISA | MO50971W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries) |
Clone | MO35907FYA |
Specificity | This antibody binds to Rhesus ANXA9. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Cytosol; Other locations; Plasma Membrane; Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The annexins are a family of calcium-dependent phospholipid-binding proteins. Members of the annexin family contain 4 internal repeat domains, each of which includes a type II calcium-binding site. The calcium-binding sites are required for annexins to aggregate and cooperatively bind anionic phospholipids and extracellular matrix proteins. This gene encodes a divergent member of the annexin protein family in which all four homologous type II calcium-binding sites in the conserved tetrad core contain amino acid substitutions that ablate their function. However, structural analysis suggests that the conserved putative ion channel formed by the tetrad core is intact. |
Product Overview | Mouse Anti-Rhesus ANXA9 Antibody is a mouse antibody against ANXA9. It can be used for ANXA9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Annexin; ANXA9 |
UniProt ID | F7E6S3 |
Protein Refseq | The length of the protein is 345 amino acids long. The sequence is show below: MSASGGKMGPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVDRSAIVDVLTNRSREQRQLISRAFQERTQQDLLKSLRAALSGNLERIVMALLQPAARFDAQELRTALKASDSAVDVAIEILATRTPPRLQECLAVYKHDFQVEAVDDITSQTNGILRDLLLALVKGGRDSYSGIIDYNLAEQDVRALQRAEGPSTEETWVPLLTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQAALLGLASVIKNTPLYFADKLHQALQETEPNYQVLIRILISRCETDLLSIRAEFKKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM. |
For Research Use Only | Not For Clinical Use.
Online Inquiry