Mouse Anti-ANXA9 Antibody (CBMOAB-35907FYA)


Cat: CBMOAB-35907FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35907FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO35907FYA 100 µg
MO-AB-00085L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00085L 100 µg
MO-AB-01453H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01453C 100 µg
MO-AB-07419R Monoclonal Cattle (Bos taurus) WB, ELISA MO07419R 100 µg
MO-AB-09192W Monoclonal Cat (Felis catus) WB, ELISA MO09192W 100 µg
MO-AB-14208Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14208Y 100 µg
MO-AB-23763R Monoclonal Pig (Sus scrofa) WB, ELISA MO23763R 100 µg
MO-AB-25021W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25021W 100 µg
MO-AB-28971W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28971W 100 µg
MO-AB-34390W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34390W 100 µg
MO-AB-41244W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41244W 100 µg
MO-AB-43685W Monoclonal Horse (Equus caballus) WB, ELISA MO43685W 100 µg
MO-AB-50971W Monoclonal Marmoset WB, ELISA MO50971W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO35907FYA
SpecificityThis antibody binds to Rhesus ANXA9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol; Other locations; Plasma Membrane; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe annexins are a family of calcium-dependent phospholipid-binding proteins. Members of the annexin family contain 4 internal repeat domains, each of which includes a type II calcium-binding site. The calcium-binding sites are required for annexins to aggregate and cooperatively bind anionic phospholipids and extracellular matrix proteins. This gene encodes a divergent member of the annexin protein family in which all four homologous type II calcium-binding sites in the conserved tetrad core contain amino acid substitutions that ablate their function. However, structural analysis suggests that the conserved putative ion channel formed by the tetrad core is intact.
Product OverviewMouse Anti-Rhesus ANXA9 Antibody is a mouse antibody against ANXA9. It can be used for ANXA9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnnexin; ANXA9
UniProt IDF7E6S3
Protein RefseqThe length of the protein is 345 amino acids long.
The sequence is show below: MSASGGKMGPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVDRSAIVDVLTNRSREQRQLISRAFQERTQQDLLKSLRAALSGNLERIVMALLQPAARFDAQELRTALKASDSAVDVAIEILATRTPPRLQECLAVYKHDFQVEAVDDITSQTNGILRDLLLALVKGGRDSYSGIIDYNLAEQDVRALQRAEGPSTEETWVPLLTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQAALLGLASVIKNTPLYFADKLHQALQETEPNYQVLIRILISRCETDLLSIRAEFKKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM.
For Research Use Only | Not For Clinical Use.
Online Inquiry